PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018054m
Common NameEUTSA_v10018054mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 1049aa    MW: 116138 Da    PI: 7.9474
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018054mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.2e-40142218278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cqv++C++dls ak+yhrrhkvCe hska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Thhalv10018054m 142 CQVDNCKEDLSLAKDYHRRHKVCELHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTQP 218
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-33134203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.812139216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-37140220IPR004333Transcription factor, SBP-box
PfamPF031101.2E-28142215IPR004333Transcription factor, SBP-box
CDDcd002045.11E-6805939No hitNo description
Gene3DG3DSA:1.25.40.201.9E-5848952IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484039.12E-7848942IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1049 aa     Download sequence    Send to blast
MVKKIVVCER EGEGEMEEVG PQVAGPILIH HSIGRKRDLY QQPHWLVPSQ PRNDWNPKMW  60
EWDSQRFEAK PVDGNGTQFD VNAMRNCNIN NGGLSYEGEE RGLDLNLSTG FNAVEDTPVV  120
TRPNKKVRSG SPGSGGGNYP KCQVDNCKED LSLAKDYHRR HKVCELHSKA TKALVGKQMQ  180
RFCQQCSRFH LLSEFDEGKR SCRRRLAGHN RRRRKTQPEE INSRVVAPGN CDNTSSNANL  240
DIMALLTALA CAQGRNDAKP NGSPAVPQRE QLLQILNKIN ALPLPMDLVS KLNKIGILAR  300
KNLDQPSGMN PQKDMNGASS PSTMDLLAVL STTLGSSAPE AIALLSQGEF GTKESEDKTK  360
LTSCDHATTT NLEMRALEFP SFGGGERSSS SNPSPSQDSD SHAQDTRSSL SLQLFTSSPE  420
DESQPTVASS RKYYSSASSN PVEDRSPSSS PVMQELFPLQ TSPETMRSNN SKNSSPSPRT  480
SCLPLELFGA SDRGAVTNPN FNHSRHQSEY ASSGSDYSPP SLNSDAQDRT GKILFKLFGK  540
DPSQLPGTLR TEIYSWLSNL PSGMESYIRP GCVILSVYVA MSASAWEQLE ENLPQRVSSL  600
VQDSEFWSNT RFLVNTGRQL ASYKHGKIRL SKSWRTLSSP ELITVSPLAV VAGEETTLLV  660
RGRSLTNTGI SFRCAHMGNY ASMEVAGTKH RSAKFDELYV NSFKVQSGIP DSLGRCFVEV  720
ENGFRSDSFP LIIANATICK ELNRLEDEFH PKDATEEQTH NSDRPRSREE VLCFLNELGW  780
LFQRKWTSDT HGESDFSLPR FKFLLVCSVE RDYCSLIRTL LDMMVERNLG KDGLMNKDSL  840
DMLAEIQLLN RAVKRRNTKM AETLIHYSVN PTTKKFIFVP NIAGPGDITP LHLAASTSAS  900
EDMIDVLTND PQEIGLSCWN TLIDASGQTP FSYAAMRNNH SYNTLVARKL ADKRNGQISL  960
NIEYGIDQIG LSKRLSSELK RSCNTCASVA LKYQRKVSGS HRLFPTPIIH SMLAVATVCV  1020
CVCVFMHAFP IVRQGSHFSW GGLDYGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29130215184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1850855RAVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2429580.0AJ242958.1 Arabidopsis thaliana partial mRNA for SPL1-Related3 protein (SPL1R3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390174.10.0hypothetical protein EUTSA_v10018054mg
SwissprotQ700C20.0SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBLV4JQE90.0V4JQE9_EUTSA; Uncharacterized protein
STRINGscaffold_202615.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76580.10.0SBP family protein